PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G18270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 356aa    MW: 37068.5 Da    PI: 7.5077
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G18270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-18172226256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OGLUM08G18270.1 172 RKKLRLSKEQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 226
                      788899***********************************************98 PP

2HD-ZIP_I/II128.33.1e-41172262192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LEesF+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  OGLUM08G18270.1 172 RKKLRLSKEQSAFLEESFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELAELR-ALK 262
                      69*************************************************************************************9.665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-18156226IPR009057Homeodomain-like
SuperFamilySSF466892.01E-18159229IPR009057Homeodomain-like
PROSITE profilePS5007117.167168228IPR001356Homeobox domain
SMARTSM003896.3E-16170232IPR001356Homeobox domain
PfamPF000461.8E-15172226IPR001356Homeobox domain
CDDcd000862.13E-17172229No hitNo description
PROSITE patternPS000270203226IPR017970Homeobox, conserved site
SMARTSM003403.5E-25228271IPR003106Leucine zipper, homeobox-associated
PfamPF021831.0E-10228262IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MELGLSLGDA VTVADGGRPE LVLGLGVGVG AGVRRGEEEE RGRREDVVGA GRWAAMAAAS  60
PEPSVRLSLV SSLGLHWPSE TGRSEAAARG FDVNRAPSVA AGAPGMEDDE EGPGAAPALS  120
SSPNDSGGSF PLDLSGHGLR GHAEAAAQGG GGGGGERSSS RASDDDEGAS ARKKLRLSKE  180
QSAFLEESFK EHSTLNPKQK VALAKQLNLR PRQVEVWFQN RRARTKLKQT EVDCEYLKRC  240
CETLTEENRR LHKELAELRA LKTARPFYMH LPATTLSMCP SCERVASNPA TASTSAPAAA  300
TSPAAAAAAP TAAARTAVTS PEPHRPSSFA ALFAAPLGFP LTAAQPRPPP PASNCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220228RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411960.0AK241196.1 Oryza sativa Japonica Group cDNA, clone: J065121H01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648883.10.0PREDICTED: homeobox-leucine zipper protein HOX27 isoform X2
SwissprotA2YW030.0HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLA0A0E0AWD50.0A0A0E0AWD5_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g36220.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-71homeobox from Arabidopsis thaliana